Lineage for d1djma_ (1djm A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1158037Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1158038Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1158049Protein CheY protein [52174] (5 species)
  7. 1158050Species Escherichia coli [TaxId:562] [52175] (40 PDB entries)
    Uniprot P06143
  8. 1158113Domain d1djma_: 1djm A: [31078]
    BeF3-activated

Details for d1djma_

PDB Entry: 1djm (more details)

PDB Description: solution structure of bef3-activated chey from escherichia coli
PDB Compounds: (A:) chemotaxis protein y

SCOPe Domain Sequences for d1djma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djma_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}
madkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnm
pnmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekl
nkifeklgm

SCOPe Domain Coordinates for d1djma_:

Click to download the PDB-style file with coordinates for d1djma_.
(The format of our PDB-style files is described here.)

Timeline for d1djma_: