Lineage for d1dj7b_ (1dj7 B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helixSuperfamily b.34.4: Electron transport accessory proteins [50090] (5 families) 
Family b.34.4.3: Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain [50098] (1 protein)
automatically mapped to Pfam PF02941Protein Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain [50099] (1 species) Species Synechocystis sp. [TaxId:1143] [50100] (7 PDB entries) 
Domain d1dj7b_: 1dj7 B: [24598]
Other proteins in same PDB: d1dj7a_
complexed with sf4, so4
Details for d1dj7b_
PDB Entry: 1dj7 (more details), 1.6 Å
PDB Description: crystal structure of ferredoxin thioredoxin reductase
PDB Compounds: (B:) ferredoxin thioredoxin reductase: variable chainSCOPe Domain Sequences for d1dj7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dj7b_ b.34.4.3 (B:) Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain {Synechocystis sp. [TaxId: 1143]}
mnvgdrvrvtssvvvyhhpehkktafdlqgmegevaavltewqgrpisanlpvlvkfeqr
fkahfrpdevtli
SCOPe Domain Coordinates for d1dj7b_:
Click to download the PDB-style file with coordinates for d1dj7b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dj7b_:
- d1dj7b_ first appeared (with stable ids) in SCOP 1.55
- d1dj7b_ appears in SCOPe 2.07
View in 3D
