Lineage for d1dd3a1 (1dd3 A:1-57)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921605Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily)
    multihelical; intertwined tetramer
  4. 921606Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family) (S)
  5. 921607Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein)
  6. 921608Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (2 species)
  7. 921620Species Thermotoga maritima [TaxId:2336] [48303] (6 PDB entries)
  8. 921627Domain d1dd3a1: 1dd3 A:1-57 [19031]
    Other proteins in same PDB: d1dd3a2, d1dd3b2

Details for d1dd3a1

PDB Entry: 1dd3 (more details), 2 Å

PDB Description: crystal structure of ribosomal protein l12 from thermotoga maritima
PDB Compounds: (A:) 50S ribosomal protein L7/L12

SCOPe Domain Sequences for d1dd3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dd3a1 a.108.1.1 (A:1-57) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Thermotoga maritima [TaxId: 2336]}
mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeekt

SCOPe Domain Coordinates for d1dd3a1:

Click to download the PDB-style file with coordinates for d1dd3a1.
(The format of our PDB-style files is described here.)

Timeline for d1dd3a1:

921627
d1dd3a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1dd3a2