Lineage for d1dara1 (1dar A:283-400)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062652Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 2062695Protein Elongation factor G (EF-G), domain II [50456] (2 species)
  7. 2062696Species Thermus thermophilus [TaxId:274] [50457] (9 PDB entries)
  8. 2062699Domain d1dara1: 1dar A:283-400 [25707]
    Other proteins in same PDB: d1dara2, d1dara3, d1dara4
    complexed with gdp

Details for d1dara1

PDB Entry: 1dar (more details), 2.4 Å

PDB Description: elongation factor g in complex with gdp
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d1dara1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dara1 b.43.3.1 (A:283-400) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvile

SCOPe Domain Coordinates for d1dara1:

Click to download the PDB-style file with coordinates for d1dara1.
(The format of our PDB-style files is described here.)

Timeline for d1dara1: