Lineage for d1d0gr2 (1d0g R:62-101)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1704289Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 1704290Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 1704291Family g.24.1.1: TNF receptor-like [57587] (6 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 1704300Protein Death receptor-5 (dr5) fragment [57590] (1 species)
  7. 1704301Species Human (Homo sapiens) [TaxId:9606] [57591] (5 PDB entries)
  8. 1704310Domain d1d0gr2: 1d0g R:62-101 [44919]
    Other proteins in same PDB: d1d0ga_, d1d0gb_, d1d0gd_
    complexed with cl, zn

Details for d1d0gr2

PDB Entry: 1d0g (more details), 2.4 Å

PDB Description: crystal structure of death receptor 5 (dr5) bound to apo2l/trail
PDB Compounds: (R:) death receptor-5

SCOPe Domain Sequences for d1d0gr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0gr2 g.24.1.1 (R:62-101) Death receptor-5 (dr5) fragment {Human (Homo sapiens) [TaxId: 9606]}
rctrcdsgevelspctttrntvcqceegtfreedspemcr

SCOPe Domain Coordinates for d1d0gr2:

Click to download the PDB-style file with coordinates for d1d0gr2.
(The format of our PDB-style files is described here.)

Timeline for d1d0gr2: