Lineage for d1czpa_ (1czp A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) 
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) 
Protein 2Fe-2S ferredoxin [54294] (19 species) Species Anabaena sp., pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries) 
Domain d1czpa_: 1czp A: [37645]
complexed with fes
Details for d1czpa_
PDB Entry: 1czp (more details), 1.17 Å
PDB Description: anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a
PDB Compounds: (A:) ferredoxin ISCOPe Domain Sequences for d1czpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Anabaena sp., pcc 7119 and 7120 [TaxId: 1167]}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly
SCOPe Domain Coordinates for d1czpa_:
Click to download the PDB-style file with coordinates for d1czpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1czpa_:
- d1czpa_ first appeared (with stable ids) in SCOP 1.55
- d1czpa_ appears in SCOPe 2.04
- d1czpa_ appears in SCOPe 2.06
- d1czpa_ appears in the current release, SCOPe 2.08
View in 3D
