Lineage for d1cx4a2 (1cx4 A:266-412)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) 
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
Pfam PF00027
Protein Regulatory subunit of Protein kinase A [51213] (2 species)
duplication: consists of two similar domainsSpecies Norway rat (Rattus norvegicus) [TaxId:10116] [63861] (2 PDB entries) 
Domain d1cx4a2: 1cx4 A:266-412 [59100]
complexed with cmp; mutant
Details for d1cx4a2
PDB Entry: 1cx4 (more details), 2.45 Å
PDB Description: crystal structure of a deletion mutant of the type ii beta regulatory subunit of camp-dependent protein kinase
PDB Compounds: (A:) camp-dependent protein kinase regulatory subunit type II betaSCOPe Domain Sequences for d1cx4a2:
Sequence, based on SEQRES records: (download)
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
esfieslpflkslevserlkvvdvigtkvyndgeqiiaqgdsadsffivesgevritmkr
kgksdieengaveiarclrgqyfgelalvtnkpraasahaigtvkclamdvqaferllgp
cmeimkrniatyeeqlvalfgtnmdiv
Sequence, based on observed residues (ATOM records): (download)
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
esfieslpflkslevserlkvvdvigtkvyndgeqiiaqgdsadsffivesgevritmkr
ngaveiarclrgqyfgelalvtnkpraasahaigtvkclamdvqaferllgpcmeimkrn
iatyeeqlvalfgtnmdiv
SCOPe Domain Coordinates for d1cx4a2:
Click to download the PDB-style file with coordinates for d1cx4a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cx4a2:
- d1cx4a2 first appeared in SCOP 1.57
- d1cx4a2 appears in SCOPe 2.02
- d1cx4a2 appears in SCOPe 2.04
- d1cx4a2 appears in the current release, SCOPe 2.08
View in 3D
