Lineage for d1cx4a1 (1cx4 A:130-265)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) 
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
Pfam PF00027
Protein Regulatory subunit of Protein kinase A [51213] (2 species)
duplication: consists of two similar domainsSpecies Norway rat (Rattus norvegicus) [TaxId:10116] [63861] (2 PDB entries) 
Domain d1cx4a1: 1cx4 A:130-265 [59099]
complexed with cmp; mutant
Details for d1cx4a1
PDB Entry: 1cx4 (more details), 2.45 Å
PDB Description: crystal structure of a deletion mutant of the type ii beta regulatory subunit of camp-dependent protein kinase
PDB Compounds: (A:) camp-dependent protein kinase regulatory subunit type II betaSCOPe Domain Sequences for d1cx4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
riihpktddqrnrlqeackdillfknldpeqmsqvldamfeklvkegehvidqgddgdnf
yvidrgtfdiyvkcdgvgrcvgnydnrgsfgelalmyntpraatitatspgalwgldrvt
frriivknnakkrkmy
SCOPe Domain Coordinates for d1cx4a1:
Click to download the PDB-style file with coordinates for d1cx4a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cx4a1:
- d1cx4a1 first appeared in SCOP 1.57
- d1cx4a1 appears in SCOPe 2.03
- d1cx4a1 appears in SCOPe 2.05
- d1cx4a1 appears in the current release, SCOPe 2.08
View in 3D
