Lineage for d1cs6a3 (1cs6 A:209-299)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764414Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1764415Protein Axonin-1 [49184] (1 species)
    tandem repeat of 4 L1 domains
  7. 1764416Species Chicken (Gallus gallus) [TaxId:9031] [49185] (1 PDB entry)
  8. 1764419Domain d1cs6a3: 1cs6 A:209-299 [21762]
    complexed with gol

Details for d1cs6a3

PDB Entry: 1cs6 (more details), 1.8 Å

PDB Description: n-terminal fragment of axonin-1 from chicken
PDB Compounds: (A:) axonin-1

SCOPe Domain Sequences for d1cs6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]}
rqyapsikakfpadtyaltgqmvtlecfafgnpvpqikwrkldgsqtskwlssepllhiq
nvdfedegtyeceaenikgrdtyqgriiiha

SCOPe Domain Coordinates for d1cs6a3:

Click to download the PDB-style file with coordinates for d1cs6a3.
(The format of our PDB-style files is described here.)

Timeline for d1cs6a3: