Lineage for d1crub_ (1cru B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
consists of six 4-stranded beta-sheet motifs; meander
Superfamily b.68.2: Soluble quinoprotein glucose dehydrogenase [50952] (1 family) 
Family b.68.2.1: Soluble quinoprotein glucose dehydrogenase [50953] (2 proteins) Protein Soluble quinoprotein glucose dehydrogenase [50954] (1 species) Species Acinetobacter calcoaceticus [TaxId:471] [50955] (4 PDB entries) 
Domain d1crub_: 1cru B: [27618]
complexed with ca, gol, hdn, pqq
Details for d1crub_
PDB Entry: 1cru (more details), 1.5 Å
PDB Description: soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine
PDB Compounds: (B:) protein (soluble quinoprotein glucose dehydrogenase)SCOPe Domain Sequences for d1crub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1crub_ b.68.2.1 (B:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}
dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkstdkelpnqtiirryt
ynkstdtlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqh
tptqqelngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngk
llqseqgpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkv
aagvpvtkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykgg
kkaitgwentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvly
vltdtagnvqkddgsvtntlenpgslikftyk
SCOPe Domain Coordinates for d1crub_:
Click to download the PDB-style file with coordinates for d1crub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1crub_:
- d1crub_ first appeared (with stable ids) in SCOP 1.55
- d1crub_ appears in SCOPe 2.07
View in 3D
