Lineage for d1crfa_ (1crf A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2583547Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2583548Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2583549Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 2583628Protein Cardiotoxin II [57334] (2 species)
  7. 2583633Species Taiwan cobra (Naja naja atra) [TaxId:8656] [57335] (4 PDB entries)
  8. 2583639Domain d1crfa_: 1crf A: [44439]

Details for d1crfa_

PDB Entry: 1crf (more details)

PDB Description: cardiotoxin ii from taiwan cobra venom, naja naja atra: structure in solution and comparision among homologous cardiotoxins
PDB Compounds: (A:) cardiotoxin II

SCOPe Domain Sequences for d1crfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1crfa_ g.7.1.1 (A:) Cardiotoxin II {Taiwan cobra (Naja naja atra) [TaxId: 8656]}
lkcnklvplfyktcpagknlcykmfmvsnltvpvkrgcidvcpknsalvkyvccntdrcn

SCOPe Domain Coordinates for d1crfa_:

Click to download the PDB-style file with coordinates for d1crfa_.
(The format of our PDB-style files is described here.)

Timeline for d1crfa_: