Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Cytochrome c2 [46650] (8 species) |
Species Paracoccus denitrificans [TaxId:266] [46657] (2 PDB entries) |
Domain d1cota_: 1cot A: [15899] complexed with hem |
PDB Entry: 1cot (more details), 1.7 Å
SCOPe Domain Sequences for d1cota_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cota_ a.3.1.1 (A:) Cytochrome c2 {Paracoccus denitrificans [TaxId: 266]} dgdaakgekefnkckachmiqapdgtdiikggktgpnlygvvgrkiaseegfkygegile vaeknpdltwteadlieyvtdpkpwlvkmtddkgaktkmtfkmgknqadvvaflaqnspd a
Timeline for d1cota_: