Lineage for d1cota_ (1cot A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980707Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1980718Protein Cytochrome c2 [46650] (8 species)
  7. 1980719Species Paracoccus denitrificans [TaxId:266] [46657] (2 PDB entries)
  8. 1980720Domain d1cota_: 1cot A: [15899]
    complexed with hem

Details for d1cota_

PDB Entry: 1cot (more details), 1.7 Å

PDB Description: x-ray structure of the cytochrome c2 isolated from paracoccus denitrificans refined to 1.7 angstroms resolution
PDB Compounds: (A:) cytochrome c2

SCOPe Domain Sequences for d1cota_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cota_ a.3.1.1 (A:) Cytochrome c2 {Paracoccus denitrificans [TaxId: 266]}
dgdaakgekefnkckachmiqapdgtdiikggktgpnlygvvgrkiaseegfkygegile
vaeknpdltwteadlieyvtdpkpwlvkmtddkgaktkmtfkmgknqadvvaflaqnspd
a

SCOPe Domain Coordinates for d1cota_:

Click to download the PDB-style file with coordinates for d1cota_.
(The format of our PDB-style files is described here.)

Timeline for d1cota_: