Lineage for d1cnsa_ (1cns A:)
- Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) Fold d.2: Lysozyme-like [53954] (1 superfamily)
common alpha+beta motif for the active site regionSuperfamily d.2.1: Lysozyme-like [53955] (12 families) 
Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins) 
Protein Plant class II chitinase [53957] (2 species) 
Species Barley (Hordeum vulgare) [TaxId:4513] [53958] (2 PDB entries) 
Domain d1cnsa_: 1cns A: [36241]
Details for d1cnsa_
PDB Entry: 1cns (more details), 1.91 Å
PDB Description: crystal structure of chitinase at 1.91a resolution
PDB Compounds: (A:) chitinaseSCOPe Domain Sequences for d1cnsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cnsa_ d.2.1.1 (A:) Plant class II chitinase {Barley (Hordeum vulgare) [TaxId: 4513]}
svssivsraqfdrmllhrndgacqakgfytydafvaaaaafsgfgttgsadvqkrevaaf
laqtshettggwatapdgafawgycfkqergassdyctpsaqwpcapgkryygrgpiqls
hnynygpagraigvdllanpdlvatdatvsfktamwfwmtaqppkpsshavivgqwspsg
adraagrvpgfgvitniinggiecghgqdsrvadrigfykrycdilgvgygnnldcysqr
pfa
SCOPe Domain Coordinates for d1cnsa_:
Click to download the PDB-style file with coordinates for d1cnsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cnsa_:
- d1cnsa_ first appeared (with stable ids) in SCOP 1.55
- d1cnsa_ appears in SCOP 1.75
- d1cnsa_ appears in SCOPe 2.02
- d1cnsa_ appears in the current release, SCOPe 2.08
View in 3D
