Lineage for d1cl7h1 (1cl7 H:1-113)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (34 PDB entries)
Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10
Domain d1cl7h1: 1cl7 H:1-113 [20419]
Other proteins in same PDB: d1cl7.1, d1cl7l1, d1cl7l2
part of Fab 1696 against HIV-1 protease
Details for d1cl7h1
PDB Entry: 1cl7 (more details), 3 Å
PDB Description: anti hiv1 protease fab
PDB Compounds: (H:) PROTEIN (IGG1 ANTIBODY 1696 (variable heavy chain))SCOPe Domain Sequences for d1cl7h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cl7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
qiqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf
addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvss
SCOPe Domain Coordinates for d1cl7h1:
Click to download the PDB-style file with coordinates for d1cl7h1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cl7h1:
- d1cl7h1 first appeared (with stable ids) in SCOP 1.55
- d1cl7h1 appears in SCOPe 2.05
- d1cl7h1 appears in SCOPe 2.07
- d1cl7h1 appears in the current release, SCOPe 2.08
View in 3D
