Lineage for d1cl5a_ (1cl5 A:)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
common core: 2 helices, disulfide-linked, and a calcium-binding loopSuperfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) Protein Snake phospholipase A2 [48624] (35 species) 
Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (53 PDB entries)
Uniprot P59071
Domain d1cl5a_: 1cl5 A: [19551]
complexed with vitamin E
Details for d1cl5a_
PDB Entry: 1cl5 (more details), 2.45 Å
PDB Description: crystal structure of phospholipase a2 from daboia russelli pulchella
PDB Compounds: (A:) protein (phospholipase a2)SCOP Domain Sequences for d1cl5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cl5a_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c
SCOP Domain Coordinates for d1cl5a_:
Click to download the PDB-style file with coordinates for d1cl5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cl5a_:
- d1cl5a_ first appeared (with stable ids) in SCOP 1.55
- d1cl5a_ appears in SCOP 1.73
- d1cl5a_ appears in SCOPe 2.01
- d1cl5a_ appears in the current release, SCOPe 2.08
View in 3D
