Lineage for d1ciya2 (1ciy A:256-461)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.77: beta-Prism I [51091] (3 superfamilies)
consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
duplication: has internal pseudo threefold symmetry
Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (2 families) 
Family b.77.2.1: delta-Endotoxin (insectocide), middle domain [51097] (1 protein) Protein delta-Endotoxin (insectocide), middle domain [51098] (5 species) 
Species Bacillus thuringiensis, CRYIA (A) [TaxId:1428] [51100] (1 PDB entry) 
Domain d1ciya2: 1ciy A:256-461 [27977]
Other proteins in same PDB: d1ciya1, d1ciya3
Details for d1ciya2
PDB Entry: 1ciy (more details), 2.25 Å
PDB Description: insecticidal toxin: structure and channel formation
PDB Compounds: (A:) cryia(a)SCOPe Domain Sequences for d1ciya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ciya2 b.77.2.1 (A:256-461) delta-Endotoxin (insectocide), middle domain {Bacillus thuringiensis, CRYIA (A) [TaxId: 1428]}
pirtvsqltreiytnpvlenfdgsfrgmaqrieqnirqphlmdilnsitiytdvhrgfny
wsghqitaspvgfsgpefafplfgnagnaappvlvsltglgifrtlssplyrriilgsgp
nnqelfvldgtefsfaslttnlpstiyrqrgtvdsldvippqdnsvppragfshrlshvt
mlsqaagavytlraptfswqhrsaef
SCOPe Domain Coordinates for d1ciya2:
Click to download the PDB-style file with coordinates for d1ciya2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ciya2:
- d1ciya2 first appeared (with stable ids) in SCOP 1.55, called d1ciy_2
- d1ciya2 appears in SCOPe 2.04
- d1ciya2 appears in SCOPe 2.06
- d1ciya2 appears in the current release, SCOPe 2.08
View in 3D
