Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Cyclodextrin glycosyltransferase [51452] (5 species) contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like |
Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [51457] (4 PDB entries) |
Domain d1ciua4: 1ciu A:1-406 [28746] Other proteins in same PDB: d1ciua1, d1ciua2, d1ciua3 complexed with ca |
PDB Entry: 1ciu (more details), 2.3 Å
SCOPe Domain Sequences for d1ciua4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ciua4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]} asdtavsnvvnystdviyqivtdrfvdgntsnnptgdlydpthtslkkyfggdwqgiink indgyltgmgvtaiwisqpveniyavlpdstfggstsyhgywardfkrtnpyfgsftdfq nlintahahnikviidfapnhtspasetdptyaengrlydngtllggytndtngyfhhyg gtdfssyedgiyrnlfdladlnqqnstidsylksaikvwldmgidgirldavkhmpfgwq knfmdsilsyrpvftfgewflgtneidvnntyfanesgmslldfrfsqkvrqvfrdntdt mygldsmiqstasdynfindmvtfidnhdmdrfynggstrpveqalaftltsrgvpaiyy gteqymtgngdpynrammtsfntsttaynvikklaplrksnpaiay
Timeline for d1ciua4: