Lineage for d1ci4a_ (1ci4 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 916790Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 917069Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 917070Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (1 protein)
  6. 917071Protein Barrier-to-autointegration factor, BAF [47800] (1 species)
  7. 917072Species Human (Homo sapiens) [TaxId:9606] [47801] (7 PDB entries)
  8. 917073Domain d1ci4a_: 1ci4 A: [17970]
    protein/DNA complex

Details for d1ci4a_

PDB Entry: 1ci4 (more details), 1.9 Å

PDB Description: the crystal structure of human barrier-to-autointegration factor (baf)
PDB Compounds: (A:) protein (barrier-to-autointegration factor (baf))

SCOPe Domain Sequences for d1ci4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ci4a_ a.60.5.1 (A:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]}
mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
ewlkdtcganakqsrdcfgclrewcdafl

SCOPe Domain Coordinates for d1ci4a_:

Click to download the PDB-style file with coordinates for d1ci4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ci4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ci4b_