Lineage for d1ceja1 (1cej A:1-45)
- Root: SCOPe 2.02
Class g: Small proteins [56992] (90 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
Superfamily g.3.11: EGF/Laminin [57196] (7 families) 
Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein) Protein Merozoite surface protein 1 (MSP-1) [57240] (3 species) 
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [57242] (3 PDB entries) 
Domain d1ceja1: 1cej A:1-45 [44336]
Details for d1ceja1
PDB Entry: 1cej (more details)
PDB Description: solution structure of an egf module pair from the plasmodium falciparum merozoite surface protein 1
PDB Compounds: (A:) protein (merozoite surface protein 1)SCOPe Domain Sequences for d1ceja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ceja1 g.3.11.4 (A:1-45) Merozoite surface protein 1 (MSP-1) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
nisqhqcvkkqcpqnsgcfrhldereeckcllnykqegdkcvenp
SCOPe Domain Coordinates for d1ceja1:
Click to download the PDB-style file with coordinates for d1ceja1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ceja1:
- d1ceja1 first appeared (with stable ids) in SCOP 1.55
- d1ceja1 appears in SCOPe 2.01
- d1ceja1 appears in SCOPe 2.03
- d1ceja1 appears in the current release, SCOPe 2.08
View in 3D
