Lineage for d1ceja1 (1cej A:1-45)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061532Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1062283Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 1062735Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein)
  6. 1062736Protein Merozoite surface protein 1 (MSP-1) [57240] (3 species)
  7. 1062740Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [57242] (3 PDB entries)
  8. 1062746Domain d1ceja1: 1cej A:1-45 [44336]

Details for d1ceja1

PDB Entry: 1cej (more details)

PDB Description: solution structure of an egf module pair from the plasmodium falciparum merozoite surface protein 1
PDB Compounds: (A:) protein (merozoite surface protein 1)

SCOPe Domain Sequences for d1ceja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ceja1 g.3.11.4 (A:1-45) Merozoite surface protein 1 (MSP-1) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
nisqhqcvkkqcpqnsgcfrhldereeckcllnykqegdkcvenp

SCOPe Domain Coordinates for d1ceja1:

Click to download the PDB-style file with coordinates for d1ceja1.
(The format of our PDB-style files is described here.)

Timeline for d1ceja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ceja2