Lineage for d1cef__ (1cef -)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 617469Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 617470Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 617471Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (13 proteins)
  6. 617722Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species)
  7. 617731Species Streptomyces sp., R61 [TaxId:1931] [56605] (14 PDB entries)
  8. 617745Domain d1cef__: 1cef - [42689]
    complexed with cef

Details for d1cef__

PDB Entry: 1cef (more details), 2.04 Å

PDB Description: cefotaxime complexed with the streptomyces r61 dd-peptidase

SCOP Domain Sequences for d1cef__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cef__ e.3.1.1 (-) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., R61}
adlpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrv
gsvtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmf
aqtvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsva
teyqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagav
isstqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtg
tvqgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp

SCOP Domain Coordinates for d1cef__:

Click to download the PDB-style file with coordinates for d1cef__.
(The format of our PDB-style files is described here.)

Timeline for d1cef__: