Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (13 proteins) |
Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species) |
Species Streptomyces sp., R61 [TaxId:1931] [56605] (14 PDB entries) |
Domain d1cef__: 1cef - [42689] complexed with cef |
PDB Entry: 1cef (more details), 2.04 Å
SCOP Domain Sequences for d1cef__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cef__ e.3.1.1 (-) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., R61} adlpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrv gsvtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmf aqtvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsva teyqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagav isstqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtg tvqgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp
Timeline for d1cef__: