Lineage for d1cdya2 (1cdy A:98-178)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.3: C2 set domains [49142] (8 proteins) 
Protein CD4 C2-set domains [49149] (2 species) Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries) 
Domain d1cdya2: 1cdy A:98-178 [21658]
Other proteins in same PDB: d1cdya1
domain 2
mutant
Details for d1cdya2
PDB Entry: 1cdy (more details), 2 Å
PDB Description: structure of t-cell surface glycoprotein cd4 mutant with gly 47 replaced by ser
PDB Compounds: (A:) T-cell surface glycoprotein cd4SCOPe Domain Sequences for d1cdya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cdya2 b.1.1.3 (A:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla
SCOPe Domain Coordinates for d1cdya2:
Click to download the PDB-style file with coordinates for d1cdya2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cdya2:
- d1cdya2 first appeared (with stable ids) in SCOP 1.55, called d1cdy_2
- d1cdya2 appears in SCOPe 2.07
View in 3D
