Lineage for d1cdia1 (1cdi A:0-97)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein CD4 V-set domains [48737] (2 species) Species Human (Homo sapiens) [TaxId:9606] [48738] (31 PDB entries) 
Domain d1cdia1: 1cdi A:0-97 [19727]
Other proteins in same PDB: d1cdia2
domain 1
Details for d1cdia1
PDB Entry: 1cdi (more details), 2.9 Å
PDB Description: structures of an hiv and mhc binding fragment from human cd4 as refined in two crystal lattices
PDB Compounds: (A:) t cell surface glycoprotein cd4SCOPe Domain Sequences for d1cdia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cdia1 b.1.1.1 (A:0-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
tkkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrr
slwdqgnfpliiknlkiedsdtyicevedqkeevqllv
SCOPe Domain Coordinates for d1cdia1:
Click to download the PDB-style file with coordinates for d1cdia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cdia1:
- d1cdia1 first appeared (with stable ids) in SCOP 1.55, called d1cdi_1
- d1cdia1 appears in SCOPe 2.03
- d1cdia1 appears in SCOPe 2.05
- d1cdia1 appears in the current release, SCOPe 2.08
View in 3D
