Lineage for d1cd1a2 (1cd1 A:7-185)
- Root: SCOPe 2.02
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimericSuperfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) 
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) 
Protein CD1, alpha-1 and alpha-2 domains [54456] (4 species)
Class I MHC-related
Species Mouse (Mus musculus) [TaxId:10090] [54457] (7 PDB entries) 
Domain d1cd1a2: 1cd1 A:7-185 [38155]
Other proteins in same PDB: d1cd1a1, d1cd1b_, d1cd1c1, d1cd1d_
Details for d1cd1a2
PDB Entry: 1cd1 (more details), 2.67 Å
PDB Description: cd1(mouse) antigen presenting molecule
PDB Compounds: (A:) cd1SCOPe Domain Sequences for d1cd1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cd1a2 d.19.1.1 (A:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
SCOPe Domain Coordinates for d1cd1a2:
Click to download the PDB-style file with coordinates for d1cd1a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cd1a2:
- d1cd1a2 first appeared (with stable ids) in SCOP 1.55
- d1cd1a2 appears in SCOPe 2.01
- d1cd1a2 appears in SCOPe 2.03
- d1cd1a2 appears in the current release, SCOPe 2.08
 View in 3DDomains from other chains: (mouse over for more information) d1cd1b_, d1cd1c1, d1cd1c2, d1cd1d_ |
