Lineage for d1c8ua2 (1c8u A:116-286)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
core: beta-alpha-beta(4); 2 layers: alpha/betaSuperfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) 
Family d.38.1.3: Acyl-CoA thioesterase [54644] (2 proteins)
duplication: consists of two domains of this foldProtein Thioesterase II (TesB) [54645] (1 species) Species Escherichia coli [TaxId:562] [54646] (1 PDB entry) 
Domain d1c8ua2: 1c8u A:116-286 [38548]
complexed with lda
has additional insertions and/or extensions that are not grouped together
Details for d1c8ua2
PDB Entry: 1c8u (more details), 1.9 Å
PDB Description: crystal structure of the e.coli thioesterase ii, a homologue of the human nef-binding enzyme
PDB Compounds: (A:) acyl-coa thioesterase IISCOPe Domain Sequences for d1c8ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c8ua2 d.38.1.3 (A:116-286) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]}
ehqktmpsapapdglpsetqiaqslahllppvlkdkficdrplevrpvefhnplkghvae
phrqvwirangsvpddlrvhqyllgyasdlnflpvalqphgigflepgiqiatidhsmwf
hrpfnlnewllysvestsassargfvrgefytqdgvlvastvqegvmrnhn
SCOPe Domain Coordinates for d1c8ua2:
Click to download the PDB-style file with coordinates for d1c8ua2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c8ua2:
- d1c8ua2 first appeared (with stable ids) in SCOP 1.55
- d1c8ua2 appears in SCOPe 2.07
View in 3D
