Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins) automatically mapped to Pfam PF00135 |
Protein Thermophilic para-nitrobenzyl esterase (PNB esterase) [53485] (1 species) |
Species Bacillus subtilis [TaxId:1423] [53486] (3 PDB entries) |
Domain d1c7ja_: 1c7j A: [34631] complexed with k, so4 |
PDB Entry: 1c7j (more details), 1.6 Å
SCOPe Domain Sequences for d1c7ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c7ja_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} thqivttqygkvkgttengvhkwkgipyakppvgqwrfkapeppevwedvldataygpvc pqpsdllslsytelprqsedclyvnvfapdtpsqnlpvmvwihggafylgagseplydgs klaaqgevivvtlnyrlgpfgfmhlssfdeaysdnlglldqaaalkwvrenisafggdpd nvtvfgesaggmsiaallampaakglfqkaimesgasrtmtkeqaastaaaflqvlgine sqldrlhtvaaedllkaadqlriaekenifqlffqpaldpktlpeepeksiaegaasgip lligttrdegylfftsdsdvrsqetldaaleyslgkplaekaadlyprslesqihmvtdl lfwrpavafasaqshyapvwmyrfdwhpekppynkafhalelpfvfgnldglermakaei tdevkqlshtiqsawitfaktgnpsteavnwpayheetretvildseitiendpesekrq klfps
Timeline for d1c7ja_: