Lineage for d1c6sa_ (1c6s A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690984Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (11 species)
  7. 2691022Species Synechococcus elongatus [TaxId:32046] [46634] (1 PDB entry)
  8. 2691023Domain d1c6sa_: 1c6s A: [15806]
    complexed with hec

Details for d1c6sa_

PDB Entry: 1c6s (more details)

PDB Description: the solution structure of cytochrome c6 from the thermophilic cyanobacterium synechococcus elongatus, nmr, 20 structures
PDB Compounds: (A:) cytochrome c6

SCOPe Domain Sequences for d1c6sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c6sa_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Synechococcus elongatus [TaxId: 32046]}
adlangakvfsgncaachmgggnvvmanktlkkealeqfgmysedaiiyqvqhgknampa
fagrltdeqiqdvaayvldqaakgwag

SCOPe Domain Coordinates for d1c6sa_:

Click to download the PDB-style file with coordinates for d1c6sa_.
(The format of our PDB-style files is described here.)

Timeline for d1c6sa_: