Lineage for d1c5da1 (1c5d A:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741585Species Norway rat (Rattus norvegicus) [TaxId:10116] [88532] (14 PDB entries)
  8. 2741600Domain d1c5da1: 1c5d A:1-106 [20414]
    Other proteins in same PDB: d1c5da2, d1c5db1, d1c5db2, d1c5dh1, d1c5dh2, d1c5dl2
    part of antibody against the main immunogenic region of the human muscle acetylcholine receptor

Details for d1c5da1

PDB Entry: 1c5d (more details), 2.4 Å

PDB Description: the crystal structure of the fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor
PDB Compounds: (A:) monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor

SCOPe Domain Sequences for d1c5da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5da1 b.1.1.1 (A:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
diqmtqsppslsaslgdkvtitcqasqdinkyiawyqqkpgkaprqlirytsilvlgtps
rfsgsgsgrdfsfsisnvasediasyyclqygnlytfgagtkleik

SCOPe Domain Coordinates for d1c5da1:

Click to download the PDB-style file with coordinates for d1c5da1.
(The format of our PDB-style files is described here.)

Timeline for d1c5da1: