Lineage for d1c3ta_ (1c3t A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931514Protein Ubiquitin [54238] (9 species)
  7. 2931628Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. 2932304Domain d1c3ta_: 1c3t A: [37594]
    designed hydrophobic core mutant

Details for d1c3ta_

PDB Entry: 1c3t (more details)

PDB Description: rotamer strain as a determinant of protein structural specificity
PDB Compounds: (A:) protein (1d8 ubiquitin)

SCOPe Domain Sequences for d1c3ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3ta_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqlfvktltgktltvelepsdtvenlkakiqdkegippdqqrlifagkqledgrtlsdyn
lqkestihlvlrlrgg

SCOPe Domain Coordinates for d1c3ta_:

Click to download the PDB-style file with coordinates for d1c3ta_.
(The format of our PDB-style files is described here.)

Timeline for d1c3ta_: