Lineage for d1c3ia_ (1c3i A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964558Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 2964559Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries)
  8. 2964562Domain d1c3ia_: 1c3i A: [40373]
    complexed with ca, tr1, zn

Details for d1c3ia_

PDB Entry: 1c3i (more details), 1.83 Å

PDB Description: human stromelysin-1 catalytic domain complexed with ro-26-2812
PDB Compounds: (A:) stromelysin-1

SCOPe Domain Sequences for d1c3ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3ia_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppds

SCOPe Domain Coordinates for d1c3ia_:

Click to download the PDB-style file with coordinates for d1c3ia_.
(The format of our PDB-style files is described here.)

Timeline for d1c3ia_: