Lineage for d1c3ab_ (1c3a B:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily)
unusual foldSuperfamily d.169.1: C-type lectin-like [56436] (9 families) 
Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
Pfam PF00059
Protein Snake coagglutinin beta chain [88867] (10 species)
heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
Species Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId:88087] [88869] (1 PDB entry) 
Domain d1c3ab_: 1c3a B: [42344]
Other proteins in same PDB: d1c3aa_
Details for d1c3ab_
PDB Entry: 1c3a (more details), 2.5 Å
PDB Description: crystal structure of flavocetin-a from the habu snake venom, a novel cyclic tetramer of c-type lectin-like heterodimers
PDB Compounds: (B:) flavocetin-a: beta subunitSCOPe Domain Sequences for d1c3ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3ab_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId: 88087]}
gfccplgwssydehcyqvfqqkmnwedaekfctqqhkgshlvsfhsseevdfvtsktfpi
lkydfvwiglsnvwnectkewsdgtkldykawsggsdcivskttdnqwlsmdcsskyyvv
ckfqa
SCOPe Domain Coordinates for d1c3ab_:
Click to download the PDB-style file with coordinates for d1c3ab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c3ab_:
- d1c3ab_ first appeared (with stable ids) in SCOP 1.55
- d1c3ab_ appears in SCOPe 2.05
- d1c3ab_ appears in SCOPe 2.07
- d1c3ab_ appears in the current release, SCOPe 2.08
View in 3D
