Lineage for d1c1ba1 (1c1b A:430-543)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2139124Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2139125Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2139176Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)
  7. 2139186Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (104 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 2139221Domain d1c1ba1: 1c1b A:430-543 [33605]
    Other proteins in same PDB: d1c1ba2, d1c1bb_
    complexed with gca

Details for d1c1ba1

PDB Entry: 1c1b (more details), 2.5 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with gca-186
PDB Compounds: (A:) hiv-1 reverse transcriptase (a-chain)

SCOPe Domain Sequences for d1c1ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1ba1 c.55.3.1 (A:430-543) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgig

SCOPe Domain Coordinates for d1c1ba1:

Click to download the PDB-style file with coordinates for d1c1ba1.
(The format of our PDB-style files is described here.)

Timeline for d1c1ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c1ba2
View in 3D
Domains from other chains:
(mouse over for more information)
d1c1bb_