Lineage for d1bzwa_ (1bzw A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1532834Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1532994Protein Legume lectin [49904] (23 species)
  7. 1533170Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (23 PDB entries)
    Uniprot P02872 24-255
  8. 1533207Domain d1bzwa_: 1bzw A: [24098]
    complexed with ca, mn

Details for d1bzwa_

PDB Entry: 1bzw (more details), 2.7 Å

PDB Description: peanut lectin complexed with c-lactose
PDB Compounds: (A:) protein (peanut lectin)

SCOPe Domain Sequences for d1bzwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzwa_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOPe Domain Coordinates for d1bzwa_:

Click to download the PDB-style file with coordinates for d1bzwa_.
(The format of our PDB-style files is described here.)

Timeline for d1bzwa_: