Lineage for d1bzsa_ (1bzs A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729341Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 729468Protein Neutrophil collagenase (MMP-8) [55532] (1 species)
  7. 729469Species Human (Homo sapiens) [TaxId:9606] [55533] (19 PDB entries)
  8. 729475Domain d1bzsa_: 1bzs A: [40348]
    complexed with bsi, ca, epe, zn

Details for d1bzsa_

PDB Entry: 1bzs (more details), 1.7 Å

PDB Description: crystal structure of mmp8 complexed with hmr2909
PDB Compounds: (A:) Neutrophil collagenase

SCOP Domain Sequences for d1bzsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzsa_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]}
fmltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadi
niafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahe
fghslglahssdpgalmypnyafretsnyslpqddidgiqaiygd

SCOP Domain Coordinates for d1bzsa_:

Click to download the PDB-style file with coordinates for d1bzsa_.
(The format of our PDB-style files is described here.)

Timeline for d1bzsa_: