Lineage for d1byub_ (1byu B:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein Ran [52609] (2 species) 
Species Dog (Canis familiaris) [TaxId:9615] [52610] (20 PDB entries)
Uniprot P62825
Domain d1byub_: 1byu B: [32033]
complexed with gdp, mg
Details for d1byub_
PDB Entry: 1byu (more details), 2.15 Å
PDB Description: canine gdp-ran
PDB Compounds: (B:) protein (GTP-binding protein ran)SCOPe Domain Sequences for d1byub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1byub_ c.37.1.8 (B:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
aaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvptlgvevhplvfhtnrgpikf
nvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcg
nkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampa
lappevvmdpalaaqyehdlevaqttalpdedddl
SCOPe Domain Coordinates for d1byub_:
Click to download the PDB-style file with coordinates for d1byub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1byub_:
- d1byub_ first appeared (with stable ids) in SCOP 1.55
- d1byub_ appears in SCOPe 2.05
- d1byub_ appears in SCOPe 2.07
- d1byub_ appears in the current release, SCOPe 2.08
View in 3D
