Lineage for d1byka_ (1byk A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
parallel beta-sheet of 6 strands, order 213456Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) 
Similar in architecture to the superfamily II but partly differs in topologyFamily c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) 
Protein Trehalose repressor, C-terminal domain [53839] (2 species) Species Escherichia coli [TaxId:562] [53840] (1 PDB entry) 
Domain d1byka_: 1byk A: [35706]
complexed with t6p
Details for d1byka_
PDB Entry: 1byk (more details), 2.5 Å
PDB Description: trehalose repressor from escherichia coli
PDB Compounds: (A:) protein (trehalose operon repressor)SCOPe Domain Sequences for d1byka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]}
sdkvvaiivtrldslsenlavqtmlpafyeqgydpimmesqfspqlvaehlgvlkrrnid
gvvlfgftgiteemlahwqsslvllardakgfasvcyddegaikilmqrlydqghrnisy
lgvphsdvttgkrrheaylafckahklhpvaalpglamkqgyenvakvitpettallcat
dtlalgaskylqeqridtlqlasvgntplmkflhpeivtvdpgyaeagrqaacqliaqvt
grsepqqiiipatls
SCOPe Domain Coordinates for d1byka_:
Click to download the PDB-style file with coordinates for d1byka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1byka_:
- d1byka_ first appeared (with stable ids) in SCOP 1.55
- d1byka_ appears in SCOPe 2.05
- d1byka_ appears in SCOPe 2.07
- d1byka_ appears in the current release, SCOPe 2.08
View in 3D
