Lineage for d1bx2b2 (1bx2 B:3-92)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545431Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2545475Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries)
    Uniprot P04229 30-219
  8. 2545485Domain d1bx2b2: 1bx2 B:3-92 [38184]
    Other proteins in same PDB: d1bx2a1, d1bx2a2, d1bx2b1, d1bx2d1, d1bx2d2, d1bx2e1
    complexed with nag

Details for d1bx2b2

PDB Entry: 1bx2 (more details), 2.6 Å

PDB Description: crystal structure of hla-dr2 (dra*0101,drb1*1501) complexed with a peptide from human myelin basic protein
PDB Compounds: (B:) protein (hla-dr2)

SCOPe Domain Sequences for d1bx2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bx2b2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
trprflwqpkrechffngtervrfldryfynqeesvrfdsdvgefravtelgrpdaeywn
sqkdileqaraavdtycrhnygvvesftvq

SCOPe Domain Coordinates for d1bx2b2:

Click to download the PDB-style file with coordinates for d1bx2b2.
(The format of our PDB-style files is described here.)

Timeline for d1bx2b2:

2545485
d1bx2b2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1bx2b1