Lineage for d1bwwa_ (1bww A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries) 
Domain d1bwwa_: 1bww A: [20518]
VL dimer of Bence-Jones protein REI
mutant
Details for d1bwwa_
PDB Entry: 1bww (more details), 1.7 Å
PDB Description: bence-jones immunoglobulin rei variable portion, t39k mutant
PDB Compounds: (A:) protein (ig kappa chain v-I region rei)SCOPe Domain Sequences for d1bwwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
tpdiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqkpgkapklliyeasnlqagv
psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit
SCOPe Domain Coordinates for d1bwwa_:
Click to download the PDB-style file with coordinates for d1bwwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bwwa_:
- d1bwwa_ first appeared (with stable ids) in SCOP 1.55
- d1bwwa_ appears in SCOPe 2.07
View in 3D
