Lineage for d1bvza2 (1bvz A:503-585)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1327895Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1328173Protein Maltogenic amylase [51031] (4 species)
  7. 1328188Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (16 PDB entries)
  8. 1328201Domain d1bvza2: 1bvz A:503-585 [27783]
    Other proteins in same PDB: d1bvza1, d1bvza3, d1bvzb1, d1bvzb3

Details for d1bvza2

PDB Entry: 1bvz (more details), 2.6 Å

PDB Description: alpha-amylase ii (tvaii) from thermoactinomyces vulgaris r-47
PDB Compounds: (A:) protein (alpha-amylase II)

SCOPe Domain Sequences for d1bvza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvza2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOPe Domain Coordinates for d1bvza2:

Click to download the PDB-style file with coordinates for d1bvza2.
(The format of our PDB-style files is described here.)

Timeline for d1bvza2: