Lineage for d1btea_ (1bte A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1962063Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1962064Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1962288Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 1962339Protein Type II activin receptor [57357] (3 species)
  7. 1962340Species Mouse (Mus musculus) [TaxId:10090] [57358] (3 PDB entries)
  8. 1962341Domain d1btea_: 1bte A: [44463]
    complexed with nag

Details for d1btea_

PDB Entry: 1bte (more details), 1.5 Å

PDB Description: crystal structure of the extracellular domain of the type ii activin receptor
PDB Compounds: (A:) protein (activin receptor type II)

SCOPe Domain Sequences for d1btea_:

Sequence, based on SEQRES records: (download)

>d1btea_ g.7.1.3 (A:) Type II activin receptor {Mouse (Mus musculus) [TaxId: 10090]}
etqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddinc
ydrtdciekkdspevyfcccegnmcnekfsyfpeme

Sequence, based on observed residues (ATOM records): (download)

>d1btea_ g.7.1.3 (A:) Type II activin receptor {Mouse (Mus musculus) [TaxId: 10090]}
etqeclffnanwerdrtnqtgvepcygrrhcfatwknisgsieivkqgcwlddincydrt
dciekkdspevyfcccegnmcnekfsyfpeme

SCOPe Domain Coordinates for d1btea_:

Click to download the PDB-style file with coordinates for d1btea_.
(The format of our PDB-style files is described here.)

Timeline for d1btea_: