Lineage for d1broa_ (1bro A:)
- Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.12: Haloperoxidase [53531] (8 proteins) Protein Bromoperoxidase A2 [53532] (1 species) Species Streptomyces aureofaciens [TaxId:1894] [53533] (2 PDB entries) 
Domain d1broa_: 1bro A: [34700]
Details for d1broa_
PDB Entry: 1bro (more details), 2.05 Å
PDB Description: bromoperoxidase a2
PDB Compounds: (A:) bromoperoxidase a2SCOPe Domain Sequences for d1broa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1broa_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]}
pfitvgqenstsidlyyedhgtgqpvvlihgfplsghswerqsaalldagyrvitydrrg
fgqssqpttgydydtfaadlntvletldlqdavlvgfsmgtgevaryvssygtariakva
flaslepfllktddnpdgaapqeffdgivaavkadryafytgffndfynldenlgtrise
eavrnswntaasggffaaaaapttwytdfradipridvpalilhgtgdrtlpientarvf
hkalpsaeyvevegaphgllwthaeevntallaflak
SCOPe Domain Coordinates for d1broa_:
Click to download the PDB-style file with coordinates for d1broa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1broa_:
- d1broa_ first appeared (with stable ids) in SCOP 1.55
- d1broa_ appears in SCOP 1.75
- d1broa_ appears in SCOPe 2.02
- d1broa_ appears in the current release, SCOPe 2.08
View in 3D
