Lineage for d1bqnb_ (1bqn B:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1692262Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1692263Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1692602Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 1692603Protein HIV-1 reverse transcriptase [56689] (3 species)
  7. 1692645Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (145 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 1692923Domain d1bqnb_: 1bqn B: [43065]
    Other proteins in same PDB: d1bqna1
    complexed with hby

Details for d1bqnb_

PDB Entry: 1bqn (more details), 3.3 Å

PDB Description: tyr 188 leu hiv-1 rt/hby 097
PDB Compounds: (B:) reverse transcriptase

SCOPe Domain Sequences for d1bqnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqnb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddllvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vepivlpekdswtvndiqklvgklnwasqiypgikvralskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyqle

SCOPe Domain Coordinates for d1bqnb_:

Click to download the PDB-style file with coordinates for d1bqnb_.
(The format of our PDB-style files is described here.)

Timeline for d1bqnb_: