Lineage for d1bi5a2 (1bi5 A:236-389)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881522Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 1881584Protein Chalcone synthase [53915] (1 species)
  7. 1881585Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (16 PDB entries)
    Uniprot P30074
  8. 1881587Domain d1bi5a2: 1bi5 A:236-389 [35986]

Details for d1bi5a2

PDB Entry: 1bi5 (more details), 1.56 Å

PDB Description: chalcone synthase from alfalfa
PDB Compounds: (A:) chalcone synthase

SCOPe Domain Sequences for d1bi5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bi5a2 c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]}
ifemvwtaqtiapdsegaidghlreagltfhllkdvpgivsknitkalveafeplgisdy
nsifwiahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstq
nglkttgeglewgvlfgfgpgltietvvlrsvai

SCOPe Domain Coordinates for d1bi5a2:

Click to download the PDB-style file with coordinates for d1bi5a2.
(The format of our PDB-style files is described here.)

Timeline for d1bi5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bi5a1