Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) |
Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins) |
Protein Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) [53308] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [53309] (12 PDB entries) |
Domain d1bho1_: 1bho 1: [34143] complexed with mg |
PDB Entry: 1bho (more details), 2.7 Å
SCOPe Domain Sequences for d1bho1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bho1_ c.62.1.1 (1:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} sdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqnn pnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplgy edvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnql rekifaieg
Timeline for d1bho1_: