Lineage for d1bhdb_ (1bhd B:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.40: CH domain-like [47575] (3 superfamilies)
core: 4 helices: bundleSuperfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) 
Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
Pfam PF00307
Protein Utrophin [47582] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47583] (2 PDB entries) 
Domain d1bhdb_: 1bhd B: [17399]
second CH domain
Details for d1bhdb_
PDB Entry: 1bhd (more details), 2 Å
PDB Description: second calponin homology domain from utrophin
PDB Compounds: (B:) utrophinSCOPe Domain Sequences for d1bhdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bhdb_ a.40.1.1 (B:) Utrophin {Human (Homo sapiens) [TaxId: 9606]}
nsekillswvrqttrpysqvnvlnfttswtdglafnavlhrhkpdlfswdkvvkmspier
lehafskaqtylgieklldpedvavrlpdkksiimyltslfevlpqqv
SCOPe Domain Coordinates for d1bhdb_:
Click to download the PDB-style file with coordinates for d1bhdb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bhdb_:
- d1bhdb_ first appeared (with stable ids) in SCOP 1.55
- d1bhdb_ appears in SCOPe 2.05
- d1bhdb_ appears in SCOPe 2.07
- d1bhdb_ appears in the current release, SCOPe 2.08
View in 3D
