Lineage for d1be3c2 (1be3 C:261-379)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 888181Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 888182Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) (S)
  5. 888183Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 888184Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 888202Species Cow (Bos taurus) [TaxId:9913] [81643] (17 PDB entries)
    Uniprot P00157
  8. 888219Domain d1be3c2: 1be3 C:261-379 [75805]
    Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3c3, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f_, d1be3g_, d1be3h_, d1be3j_, d1be3k_
    complexed with fes, hec, hem

Details for d1be3c2

PDB Entry: 1be3 (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine
PDB Compounds: (C:) cytochrome bc1 complex

SCOP Domain Sequences for d1be3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1be3c2 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

SCOP Domain Coordinates for d1be3c2:

Click to download the PDB-style file with coordinates for d1be3c2.
(The format of our PDB-style files is described here.)

Timeline for d1be3c2: