Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
Family d.185.1.1: MPP-like [63412] (6 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
Protein Cytochrome bc1 core subunit 1 [63408] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [55997] (18 PDB entries) Uniprot P31800 |
Domain d1be3a1: 1be3 A:1-233 [58950] Other proteins in same PDB: d1be3b1, d1be3b2, d1be3c2, d1be3c3, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f_, d1be3g_, d1be3h_, d1be3j_, d1be3k_ complexed with fes, hec, hem |
PDB Entry: 1be3 (more details), 3 Å
SCOPe Domain Sequences for d1be3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1be3a1 d.185.1.1 (A:1-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]} tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlsp
Timeline for d1be3a1: