Lineage for d1bccj_ (1bcc J:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238567Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
  5. 1238568Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 1238569Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    interacts with cytochrome c1 and ISP
  7. 1238576Species Chicken (Gallus gallus) [TaxId:9031] [81510] (3 PDB entries)
  8. 1238577Domain d1bccj_: 1bcc J: [43703]
    Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccc2, d1bccc3, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_
    complexed with bog, fes, hem, pee, u10

Details for d1bccj_

PDB Entry: 1bcc (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken
PDB Compounds: (J:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d1bccj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bccj_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Chicken (Gallus gallus) [TaxId: 9031]}
tltarlysllfrrtstfaltivvgallferafdqgadaiyehinegklwkhikhkyenk

SCOPe Domain Coordinates for d1bccj_:

Click to download the PDB-style file with coordinates for d1bccj_.
(The format of our PDB-style files is described here.)

Timeline for d1bccj_: