SCOPe 2.04: Domain d1bcce1: 1bcc E:70-196

Lineage for d1bcce1 (1bcc E:70-196)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)

Fold b.33: ISP domain [50021] (1 superfamily)
consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

Superfamily b.33.1: ISP domain [50022] (4 families)
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species)
Species Chicken (Gallus gallus) [TaxId:9031] [50026] (3 PDB entries)
Uniprot P13272 79-274 ! Uniprot P13272 # precursor of chains I,E and V,R

Domain d1bcce1: 1bcc E:70-196 [24431]
Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccc2, d1bccc3, d1bccd2, d1bccd3, d1bcce2, d1bccf_, d1bccg_, d1bcch_, d1bccj_
complexed with bog, fes, hem, pee, u10

Details for d1bcce1

PDB Entry: 1bcc (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

PDB Compounds: (E:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d1bcce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcce1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Chicken (Gallus gallus) [TaxId: 9031]}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOPe Domain Coordinates for d1bcce1:

Click to download the PDB-style file with coordinates for d1bcce1.
(The format of our PDB-style files is described here.)

Timeline for d1bcce1: