Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
Protein Cytochrome bc1 core subunit 2 [63409] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [56001] (3 PDB entries) |
Domain d1bccb1: 1bcc B:18-235 [58948] Other proteins in same PDB: d1bcca1, d1bcca2, d1bccc2, d1bccc3, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_, d1bccj_ complexed with bog, fes, hem, pee, u10 |
PDB Entry: 1bcc (more details), 3.16 Å
SCOPe Domain Sequences for d1bccb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bccb1 d.185.1.1 (B:18-235) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]} pphpqdleitklpnglviaslenyspgstigvfikagsryenssnlgtshllrlassltt kgassfkitrgieavggklsvestrenmaytveclrddveilmefllnvttapefrpwev adlqpqlkidkavafqnpqthvienlhaaayrnaladslycpdyrigkvtsvelhdfvqn hftsarmalvglgvshpvlknvaeqllnirgglglsga
Timeline for d1bccb1: